-
Notifications
You must be signed in to change notification settings - Fork 1
Update impress setup instructions #20
New issue
Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.
By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.
Already on GitHub? Sign in to your account
base: main
Are you sure you want to change the base?
Changes from all commits
File filter
Filter by extension
Conversations
Jump to
Diff view
Diff view
There are no files selected for viewing
| Original file line number | Diff line number | Diff line change |
|---|---|---|
|
|
@@ -77,56 +77,61 @@ eval "$(conda shell.posix hook)" | |
| conda activate $WORK_DIR/ve.impress | ||
| ``` | ||
|
|
||
| ### AlphaFold2 | ||
| ### AlphaFold2 (apptainer-overlay.sh) | ||
|
|
||
| ```shell | ||
| export AF_INPUTS=$BASE_DIR/alphafold/inputs | ||
| export AF_OUTPUTS=$BASE_DIR/alphafold/outputs | ||
| export AF_ETC=$BASE_DIR/alphafold/etc | ||
|
|
||
| export XLA_PYTHON_CLIENT_PREALLOCATE="false" | ||
| export XLA_PYTHON_CLIENT_MEM_FRACTION=".75" | ||
| export XLA_PYTHON_CLIENT_ALLOCATOR="platform" | ||
|
|
||
| mkdir -p $BASE_DIR/alphafold/inputs $BASE_DIR/alphafold/outputs | ||
| cat > $BASE_DIR/alphafold/inputs/test.fasta <<EOF | ||
| >3SFJ_1|Chains A, C|Tax1-binding protein 3|Homo sapiens (9606) | ||
| VTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQ | ||
| >3SFJ_2|Chains B, D|decameric peptide iCAL36| | ||
| ANSRWPTSII | ||
| EOF | ||
|
|
||
| singularity run -B $AF_INPUTS:/inputs -B $AF_OUTPUTS:/outputs -B $AF_ETC:/etc \ | ||
| -B $AF_DB:/data --pwd /app/alphafold --nv $AF_CONTAINER \ | ||
| --data_dir=/data \ | ||
| --uniref90_database_path=/data/uniref90/uniref90.fasta \ | ||
| --mgnify_database_path=/data/mgnify/mgy_clusters_2022_05.fa \ | ||
| --template_mmcif_dir=/data/pdb_mmcif/mmcif_files/ \ | ||
| --obsolete_pdbs_path=/data/pdb_mmcif/obsolete.dat \ | ||
| --fasta_paths=/inputs/test.fasta \ | ||
| --output_dir=/outputs \ | ||
| --model_preset=multimer \ | ||
| --db_preset=reduced_dbs \ | ||
| --small_bfd_database_path=/data/small_bfd/bfd-first_non_consensus_sequences.fasta \ | ||
| --pdb_seqres_database_path=/data/pdb_seqres/pdb_seqres.txt \ | ||
| --uniprot_database_path=/data/uniprot/uniprot.fasta \ | ||
| --max_template_date=2020-12-01 \ | ||
| --use_gpu_relax=True | ||
|
|
||
| singularity run -B $AF_INPUTS:/inputs -B $AF_OUTPUTS:/outputs -B $AF_ETC:/etc \ | ||
| -B $AF_DB:/data --pwd /app/alphafold --nv $AF_CONTAINER \ | ||
| --data_dir=/data \ | ||
| --uniref90_database_path=/data/uniref90/uniref90.fasta \ | ||
| --mgnify_database_path=/data/mgnify/mgy_clusters_2022_05.fa \ | ||
| --template_mmcif_dir=/data/pdb_mmcif/mmcif_files/ \ | ||
| --obsolete_pdbs_path=/data/pdb_mmcif/obsolete.dat \ | ||
| --fasta_paths=/inputs/test.fasta \ | ||
| --output_dir=/outputs \ | ||
| --model_preset=multimer \ | ||
| --db_preset=full_dbs \ | ||
| --bfd_database_path=/data/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \ | ||
|
Collaborator
There was a problem hiding this comment. Choose a reason for hiding this commentThe reason will be displayed to describe this comment to others. Learn more. there are two configurations for tests (depends on what's available), thus would be good to preserve both of them |
||
| --pdb_seqres_database_path=/data/pdb_seqres/pdb_seqres.txt \ | ||
| --uniprot_database_path=/data/uniprot/uniprot.fasta \ | ||
| --uniref30_database_path=/data/uniref30/UniRef30_2021_03 \ | ||
| --max_template_date=2020-12-01 \ | ||
| --use_gpu_relax=True | ||
|
|
||
| INPUT_FASTA_FILE_DIR=$1 | ||
| INPUT_FASTA_FILE_NAME=$2 | ||
| OUTPUT_DATA_DIR=$3 | ||
|
|
||
| apptainer run --nv \ | ||
| --bind $INPUT_FASTA_FILE_DIR:/fasta \ | ||
| --bind $OUTPUT_DATA_DIR:/dimer_models \ | ||
| --bind /scratch/rhaas/SUP-5301/database:/database \ | ||
| /scratch/rhaas/SUP-5301/alphafold.sif \ | ||
|
Comment on lines
+98
to
+101
Collaborator
There was a problem hiding this comment. Choose a reason for hiding this commentThe reason will be displayed to describe this comment to others. Learn more. would be good to keep in sync with the original binding folders and use env variables for the container and database ( |
||
| --data_dir=/database \ | ||
| --uniref90_database_path=/database/uniref90/uniref90.fasta \ | ||
| --mgnify_database_path=/database/mgnify/mgy_clusters_2022_05.fa \ | ||
| --template_mmcif_dir=/database/pdb_mmcif/mmcif_files/ \ | ||
| --obsolete_pdbs_path=/database/pdb_mmcif/obsolete.dat \ | ||
| --fasta_paths=/fasta/$INPUT_FASTA_FILE_NAME \ | ||
| --output_dir=/dimer_models \ | ||
| --model_preset=multimer \ | ||
| --db_preset=reduced_dbs \ | ||
| --small_bfd_database_path=/database/small_bfd/bfd-first_non_consensus_sequences.fasta \ | ||
| --uniprot_database_path=/database/uniprot/uniprot.fasta \ | ||
| --pdb_seqres_database_path=/database/pdb_seqres/pdb_seqres.txt \ | ||
| --max_template_date=2020-12-01 \ | ||
| --use_gpu_relax=True | ||
| ``` | ||
|
|
||
| --- | ||
| **NOTE** | ||
|
|
||
| To use the `Apptainer` or `Singularity` AlphaFold2 container with `RADICAL-Pilot`, you need to create an environment at the pilot level and pass it to the container task as follows: | ||
|
|
||
| ```python | ||
| pilot.prepare_env('bs0', {'type' : 'shell'}) | ||
| # create a new task description, and fill it. | ||
| td = rp.TaskDescription() | ||
| td.pre_exec = ['module load cuda/12.3.0'] | ||
| td.executable = '/bin/bash' | ||
| td.arguments = ['/scratch/bblj/alsaadi1/AF-SUP-5301/apptainer-overlay.sh'] | ||
| td.named_env = 'bs0' | ||
| ``` | ||
| Failure to specify `td.named_env = 'bs0'` will result in a container internal error due to a mismatch in Python libraries. | ||
|
|
||
| --- | ||
|
|
||
| ### PyRosetta | ||
|
|
||
|
|
||
Uh oh!
There was an error while loading. Please reload this page.
There was a problem hiding this comment.
Choose a reason for hiding this comment
The reason will be displayed to describe this comment to others. Learn more.
this shouldn't be removed, this is a test example