Open
Conversation
mtitov
reviewed
May 27, 2025
Comment on lines
-88
to
-93
| cat > $BASE_DIR/alphafold/inputs/test.fasta <<EOF | ||
| >3SFJ_1|Chains A, C|Tax1-binding protein 3|Homo sapiens (9606) | ||
| VTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQ | ||
| >3SFJ_2|Chains B, D|decameric peptide iCAL36| | ||
| ANSRWPTSII | ||
| EOF |
Collaborator
There was a problem hiding this comment.
this shouldn't be removed, this is a test example
Comment on lines
+98
to
+101
| --bind $INPUT_FASTA_FILE_DIR:/fasta \ | ||
| --bind $OUTPUT_DATA_DIR:/dimer_models \ | ||
| --bind /scratch/rhaas/SUP-5301/database:/database \ | ||
| /scratch/rhaas/SUP-5301/alphafold.sif \ |
Collaborator
There was a problem hiding this comment.
would be good to keep in sync with the original binding folders and use env variables for the container and database ($AF_CONTAINER and $AF_DB respectively)
| --output_dir=/outputs \ | ||
| --model_preset=multimer \ | ||
| --db_preset=full_dbs \ | ||
| --bfd_database_path=/data/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \ |
Collaborator
There was a problem hiding this comment.
there are two configurations for tests (depends on what's available), thus would be good to preserve both of them
Collaborator
Author
|
@mtitov This PR is out of date now. |
Collaborator
Author
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment
Add this suggestion to a batch that can be applied as a single commit.This suggestion is invalid because no changes were made to the code.Suggestions cannot be applied while the pull request is closed.Suggestions cannot be applied while viewing a subset of changes.Only one suggestion per line can be applied in a batch.Add this suggestion to a batch that can be applied as a single commit.Applying suggestions on deleted lines is not supported.You must change the existing code in this line in order to create a valid suggestion.Outdated suggestions cannot be applied.This suggestion has been applied or marked resolved.Suggestions cannot be applied from pending reviews.Suggestions cannot be applied on multi-line comments.Suggestions cannot be applied while the pull request is queued to merge.Suggestion cannot be applied right now. Please check back later.
No description provided.