Skip to content

Update impress setup instructions#20

Open
AymenFJA wants to merge 1 commit intomainfrom
feature/update_setup
Open

Update impress setup instructions#20
AymenFJA wants to merge 1 commit intomainfrom
feature/update_setup

Conversation

@AymenFJA
Copy link
Copy Markdown
Collaborator

No description provided.

@AymenFJA AymenFJA added documentation Improvements or additions to documentation enhancement New feature or request labels Jan 22, 2025
@AymenFJA AymenFJA self-assigned this Jan 22, 2025
@AymenFJA AymenFJA requested a review from mtitov March 17, 2025 18:00
Copy link
Copy Markdown
Collaborator

@mtitov mtitov left a comment

Choose a reason for hiding this comment

The reason will be displayed to describe this comment to others. Learn more.

@AymenFJA sorry for the late review, let's make updates accordingly, so @mgoliyad can try it as well and expend this instruction doc by adding Anvil

Comment on lines -88 to -93
cat > $BASE_DIR/alphafold/inputs/test.fasta <<EOF
>3SFJ_1|Chains A, C|Tax1-binding protein 3|Homo sapiens (9606)
VTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQ
>3SFJ_2|Chains B, D|decameric peptide iCAL36|
ANSRWPTSII
EOF
Copy link
Copy Markdown
Collaborator

@mtitov mtitov May 27, 2025

Choose a reason for hiding this comment

The reason will be displayed to describe this comment to others. Learn more.

this shouldn't be removed, this is a test example

Comment on lines +98 to +101
--bind $INPUT_FASTA_FILE_DIR:/fasta \
--bind $OUTPUT_DATA_DIR:/dimer_models \
--bind /scratch/rhaas/SUP-5301/database:/database \
/scratch/rhaas/SUP-5301/alphafold.sif \
Copy link
Copy Markdown
Collaborator

Choose a reason for hiding this comment

The reason will be displayed to describe this comment to others. Learn more.

would be good to keep in sync with the original binding folders and use env variables for the container and database ($AF_CONTAINER and $AF_DB respectively)

--output_dir=/outputs \
--model_preset=multimer \
--db_preset=full_dbs \
--bfd_database_path=/data/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \
Copy link
Copy Markdown
Collaborator

Choose a reason for hiding this comment

The reason will be displayed to describe this comment to others. Learn more.

there are two configurations for tests (depends on what's available), thus would be good to preserve both of them

@AymenFJA
Copy link
Copy Markdown
Collaborator Author

AymenFJA commented May 27, 2025

@mtitov This PR is out of date now.

@AymenFJA AymenFJA marked this pull request as draft May 27, 2025 15:27
@AymenFJA AymenFJA marked this pull request as ready for review May 27, 2025 15:37
@AymenFJA
Copy link
Copy Markdown
Collaborator Author

AymenFJA commented May 27, 2025

@mtitov This PR is out of date now.

@mtitov I apologize for the confusion. This PR is still valid.

Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment

Labels

documentation Improvements or additions to documentation enhancement New feature or request

Projects

None yet

Development

Successfully merging this pull request may close these issues.

2 participants