Below you will find the Docker images Lunar uses to power local development using PHP and Apache, based on the official PHP images on Docker hub. To use a specific version when setting up your docker-compose.yml, append the version number when specifying the image name.
All builds should be targeting both the linux/amd64 and linux/amr64 platforms. Make sure you are signed in to Docker Hub in your Docker for Mac/Windows client before building and pushing.
Specific version (e.g. PHP 8.0):
cd 8.0
docker buildx build --platform linux/amd64,linux/arm64 -t lunarbe/php:8.0 --push .Specific version + latest (e.g. PHP 8.1):
cd 8.1
docker buildx build --platform linux/amd64,linux/arm64 -t lunarbe/php:8.1 -t lunarbe/php:latest --push .Currently the following tags are available (latest being equal to 8.1):
lunarbe/php:5.6lunarbe/php:7.0lunarbe/php:7.1lunarbe/php:7.2lunarbe/php:7.3
lunarbe/php:7.4lunarbe/php:8.0lunarbe/php:8.1lunarbe/php:8.2(soon)lunarbe/php:latest
In the nearby future, we will start offering PHP-FPM images as well, for now all of the above are based on mod-php in Apache.
Each image has the core extensions available and/or enabled, and additionally has the following non-core extensions enabled:
bcmathexifgdgmpimagickintlmcryptmysqlipcntlpdopdo_mysqlsoapsocketszip
Additionally, composer will be installed for you as well.
At Lunar, we use these images in conjunction with DNSmasq and nginx-proxy to resolve our local domain names to their respective containers using the VIRTUAL_HOST environment variable. However, feel free to use these images in your own stacks, as they will work just as well without the aforementioned setup.
For example, to use one of our images in your setup, add the following to your docker-compose.yml:
services:
httpd:
container_name: <your_container_name>
image: lunarbe/php:8.1Apache will be listening to port 80 and will not bind to any of the host ports. Make sure you set up your port
bindings accordingly, or access the container via its IP, e.g. 172.0.10.45:80.